PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009612669.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 238aa    MW: 26575.2 Da    PI: 9.8037
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009612669.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.52.3e-18100154256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ ++tk q   Lee F+++++++ +++++LA+kl++  rqV vWFqNrRa+ k
  XP_009612669.1 100 RKKLRLTKVQSALLEESFKQHSTLNPKQKQHLARKLNVRPRQVEVWFQNRRARTK 154
                     678899***********************************************98 PP

2HD-ZIP_I/II119.81.5e-38100189191
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                     +kk+rl+k q++lLEesF+++++L+p++K++lar+L+++prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l++en++L ke +eL+ +l
  XP_009612669.1 100 RKKLRLTKVQSALLEESFKQHSTLNPKQKQHLARKLNVRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCESLTDENRKLYKELQELK-AL 189
                     69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.42E-1886157IPR009057Homeodomain-like
PROSITE profilePS5007116.5296156IPR001356Homeobox domain
SMARTSM003891.6E-1498160IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.608.2E-17100154IPR009057Homeodomain-like
CDDcd000861.65E-15100157No hitNo description
PfamPF000468.3E-16100154IPR001356Homeobox domain
PROSITE patternPS000270131154IPR017970Homeobox, conserved site
SMARTSM003402.4E-22156199IPR003106Leucine zipper, homeobox-associated
PfamPF021834.7E-9156190IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MGFDDICGTG LALKLGFSST ANNQRSRKPP ADLLGKEGSL SFEPSLTLSL PKDQSADHLS  60
SSTYSNASVK RKRDISTEVE RVLSSRVSDE DLDDHVSNGR KKLRLTKVQS ALLEESFKQH  120
STLNPKQKQH LARKLNVRPR QVEVWFQNRR ARTKLKQTEV DCEFLKKCCE SLTDENRKLY  180
KELQELKALK LAQPLYRQLP AAATLAVCPS CERVAGAGEN APAKPHFYSP FTSPSATC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1148156RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009612669.11e-176PREDICTED: homeobox-leucine zipper protein HAT22-like
RefseqXP_016455411.11e-176PREDICTED: homeobox-leucine zipper protein HAT22-like
SwissprotP466046e-84HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLA0A0V0HTW91e-106A0A0V0HTW9_SOLCH; Putative homeobox-leucine zipper protein HAT22-like
STRINGPGSC0003DMT4000551991e-104(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29024186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.11e-72HD-ZIP family protein